PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G018700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 685aa    MW: 75861.1 Da    PI: 6.6893
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G018700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.8e-094474841954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Manes.02G018700.1.p 447 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 484
                          554459******************************88 PP

2BELL1153.8e-37308379172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          e++elqk+k+kLls+leeV++rY+ y++q++ v+ssFe+vag g+a++Y +lA+ka+SrhFrcL+d i+ qi
  Manes.02G018700.1.p 308 EFMELQKRKTKLLSMLEEVERRYRYYCDQMKNVVSSFETVAGAGAATVYSALASKAMSRHFRCLRDGIVAQI 379
                          679*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.3E-58244377IPR006563POX domain
PfamPF075266.3E-47250375IPR006563POX domain
PROSITE profilePS5007112.179425488IPR001356Homeobox domain
SMARTSM003895.8E-9428492IPR001356Homeobox domain
CDDcd000864.47E-11428489No hitNo description
SuperFamilySSF466896.42E-17429494IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27431494IPR009057Homeodomain-like
PfamPF059209.3E-18445484IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MARKLCEDKS SNMASSSSAG FCYTDVSSSN PTIQTHLGNQ IQGFESNPEI FNLTTGVEMI  60
GFSRNLQQQQ SDSNTTVMWK GFLSKPGNNN TGGGGGGPSS SKTIIESTSD FYQHEFNKQD  120
FTTGISETSN GNLIVGPDSS APWQEHRLLV DDSSLRCVFP CEGNERPSQG LSLSLSSTNP  180
SSIGLQSFEL RHASSHQNHD NPQEEMRFMN SSSRDGFFGK SASNIQQQQM MQEGFLTKAA  240
TLHHQGQFQL RNSRFLGPAQ ELLNEFCCLG TKQTDQLRPK TSKPKQWDDE NGSTSGSSSR  300
KQSLCSLEFM ELQKRKTKLL SMLEEVERRY RYYCDQMKNV VSSFETVAGA GAATVYSALA  360
SKAMSRHFRC LRDGIVAQIH ATKKAMGEKD PAAPGTTRGE TPRLRVLDQA LRQQRAIQQM  420
TMMESHPWRP QRGLPERSVS VLRAWLFEHF LHPYPSDVDK HILARQTGLS RSQVSNWFIN  480
ARVRLWKPMV EEMYLEETKE QDNNVMASSD GVADLEDNND RPHTNPSSTD QKPSLDQLIR  540
IDSECLSSII SNPDKNNDTS KGTKTFQNQH LHLQQQNFGA FGAVELDFSS YNHHTASGVS  600
FANNDHGANQ NFNGGGVSLT LGLQQHGGGG VSLAFSPASQ SSLFYPRDHI DDCPPVQYSL  660
LDGEAQNLPY RNLMGAQLLH DLAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-15434491158Homeobox protein Meis1
4xrs_A1e-15434491158Homeobox protein Meis1
3k2a_B1e-15434492563Homeobox protein Meis2
3k2a_A1e-15434492563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002509843.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_015571681.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_015571687.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-150BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLB9RCF90.0B9RCF9_RICCO; Bel1 homeotic protein, putative
STRINGPOPTR_0003s13120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-136TALE family protein